subject

Spanish, 02.04.2020 02:09 lorihab1970

Read and choose the option with the correct country.

Soy Fernanda y tengo 16 años. Mi abuelo es muy tradicional y no puedo salir sola con un amigo. Tengo que salir con un grupo de amigos y amigas.

Cuba

Puerto Rico

Estados Unidos

República Dominicana

ansver

Answers: 2

Show answers

Another question on Spanish

question

Spanish, 23.06.2019 18:20

5to get 12 ngwr klg wknwk vnw vnw vnw gw igh pighwe pgiqe pghw pighw

Answers: 1

question

Spanish, 24.06.2019 16:30

Which word best completes this sentence? en mi tengo un sótano, un salón, tres dormitorios, un altillo grande y una terraza donde puedo ver la mar. a. casa b. piso c. hall de entrada d. baño e. cocina

Answers: 1

question

Spanish, 24.06.2019 17:00

Correct answer only ! el sábado pasado yo ) en un restaurante con mi familia

Answers: 2

question

Spanish, 24.06.2019 20:00

In which genre will you find ironic expressions used to comment on some reality or fact? a. la satira b. el drama c. la biografia. d. la novela policial

Answers: 1

You know the right answer?

Read and choose the option with the correct country.

Soy Fernanda y tengo 16 años. Mi ab...

Questions

question

Mathematics, 14.12.2019 07:31

What is 1/5 3/7 2/7 5/8 4/5 as greatest to least...

question

History, 14.12.2019 07:31

50 points // native american questionthe tribal would observe the war games to determine the youths’ preparedness for real battle situati...

question

Social Studies, 14.12.2019 07:31

Which of the following was one way islam influenced the songhai empire?...

question

History, 14.12.2019 07:31

50 points // native american question which of the following statements about native warriors is incorrect? select the best answer...

question

Social Studies, 14.12.2019 07:31

Iwill mark as the brainliest answerplz put in order

question

Mathematics, 14.12.2019 07:31

25 the sequence 5, 20, 35, 50….. shows the number of sit-ups margie did each week, starting with her first week of the new year. (a) what...

question

English, 14.12.2019 07:31

Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...

question

Arts, 14.12.2019 07:31

Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian

question

Health, 14.12.2019 07:31

Which of the following is an example of a processed food...

question

English, 14.12.2019 07:31

How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...

question

Mathematics, 14.12.2019 07:31

25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...

question

Mathematics, 14.12.2019 07:31

Find two consecutive positive integers such that the square of the smaller integer added to seven times the larger integer is equal to 85...

question

English, 14.12.2019 07:31

Hernandez, sylvester . "re: why does animal testing make me crazy? " animalrightsblog. animalforallblog. com, 29 sept. 2008. weba. it was...

question

Mathematics, 14.12.2019 07:31

The local business club has 240 members.its rules state that a two-thirds majority isneeded to amend the bylaws. a certainfaction ha...

question

Mathematics, 14.12.2019 07:31

If i have -2x and i have to divide it by itself do i divide by 2 or -2?...

question

Mathematics, 14.12.2019 07:31

The midpoint of mn is point p at (–4, 6). if point m is at (8, –2), what are the coordinates of point n?...

question

Chemistry, 14.12.2019 07:31

Describe the chemical reaction based on the chemical equation

question

Mathematics, 14.12.2019 07:31

The endpoints of rs are r(–5, 12) and s(4, –6). what are the coordinates of point t, which divides rs into a 4: 5 ratio?...

question

History, 14.12.2019 07:31

Im a complete paragragh explain how intrest in ancient text led to demands for church reform. at least three detauld ina well writyen paragraph about...

question

Computers and Technology, 14.12.2019 07:31

Which is an example of synchronous communication. text message e-mail voicemail telephone conversation...

More questions: Spanish Another questions